Core структурный белок

Серологические методы диагностики вирусного гепатита С



Вирус гепатита С в первую очередь вызывает нарушение функций печени, отчего данное заболевание и приобрело собственное наименование: hepar – печень, itis – воспаление. В основе распространения вируса лежит его парентеральный способ передачи. Это значит, что заражение происходит через кровь (во время инъекций, гемотрансфузий, в маникюрном и тату салоне, т. е. при манипуляциях необработанными инструментами), а также посредством полового контакта.

Вирусный гепатит С также называют «ласковым убийцей». Это связано с его мягким течением, сглаженным острым периодом и тенденцией к хронизации (30-70 %). Примерно у трети пациентов на фоне гепатита С возникает цирроз печени, а также повышается риск развития карциномы.

Вирус гепатита С состоит из одноцепочной молекулы рибонуклеиновый кислоты и относится к роду флавивирусов. Его не удается обнаружить применяя электронный микроскоп, данная проблема является следствием невысокой концентрацией вируса в крови. Вирус гепатита С обнаружен и описан благодаря применению лабораторных методов исследования.

Цепочка рибонуклеиновый кислоты вируса включает в себя приблизительно десять тысяч нуклеотидов. Также было обнаружено три структурных протеина, которые входят в состав вируса гепатита С:

  • поверхностный белок Е;
  • мембранный белок М;
  • структурный белок С;

Антитела, вырабатываемые на эти протеины, являются специфическими маркерами, используемыми для диагностики вирусного гепатита С.



Данные протеины имеют схожие антигенные характеристики, следствием чего будет совокупный биогенный маркер для всех трех белков. Таким маркером служит анти-HCV-core-Ig.

Кроме вышеупомянутых, есть также группа неструктурных протеинов, участвующих в синтезе новых цепочек РНК.

Способы диагностики и контроля

Печень является «рекордсменом» в плане многообразия выполняемых ею функций. Вирусные гепатиты, мешая нормальному функционированию печени, стимулируют нарушение почти всех лабораторных характеристик нормального состояния организма.

Множество данных перемен носит в себе неспецифический характер, т. е. такое состояние может указывать на присутствие других заболеваний.

Также имеются и признаки, свойственные непосредственно вирусному гепатиту. Таким образом, массивный цитолиз гепатоцитов приводит к выделению большего количества печеночных ферментов в кровь.



Собственно наиболее важными для оценки масштабов повреждения печени является определение уровня концентрации аланинаминотрансферазы (АлАт) и аспартатаминотрансферазы (АсАт).

Характерно при вирусном гепатите повышение уровня данных ферментов в десятки раз, причем АлАТ превалирует над АсАТ. Уровень аминотрансфераз повышается еще до развития симптоматики, поэтому определение уровня АлАТ и АсАТ является очень важным методом диагностики при заболеваниях печени.

Следует также упомянуть о нарушении билирубинового обмена. Желтушность является следствием отложения свободного билирубина в клетках кожи, что помимо изменения окраски может также вызывать чувство зуда.

Вследствие выделения большого количества уробилиногена может изменяться окраска мочи (цвет темного пива).

В случае хронического течения важным методом диагностики является проведение биопсии с последующим гистологическим анализом. Данный способ исследования позволяет оценить уровень и масштаб нарушений печеночных клеток.



Исследование маркеров недуга

Из-за очень низкой концентрации вирусных частиц, циркулирующих по кровеносной системе, обнаружить вирус гепатита С непосредственно в крови невозможно. Поэтому исследуются специфические маркеры, которые упрощают постановку диагноза.

Антитела. В качестве скринингового метода исследования, в первую очередь применяют имунно-ферментный анализ. Данный метод применяют для установки суммарных специфических иммуноглобулинов группы М и G (анти-HCV) либо анти-HCV группы IgG.

Также можно использовать в качестве уточняющего теста метод иммуноблота. Чтобы уточнить фазу заболевания, существуют специальные методы анализа, применяемые с целью выявления специфических антител к структурным белкам вируса, а также анти-NS-IgG (специфические иммуноглобулины, вырабатываемые против неструктурных протеинов). В случае классического течения заболевания анти-HCV обнаруживаются в период реконвалесценции (на 4-9 мес. после инфицирования).

Но в отдельных вариантах антитела выявлялись и ранее (2-4 неделя), а иногда и значительно позже (через год после инфицирования). Учитывая тот факт, что вирусный гепатит имеет хроническую форму протекания, антитела можно обнаружить в течение длительного периода времени. Запоздалая сероконверсия часто поддается неверной расшифровке, ведь специфические антитела могут еще не выработаться, а кровь уже инфицирована.

Выявление HCV-RNA. Цепочку HCV-RNA выявляют в крови либо в биоптате печени, применяя для этого полимеразно-цепную реакцию. На теоретическом уровне восприимчивость ПЦР дает возможность установить одну вирусную частичку в пробе.



На сегодняшний день уровень развития технологий дает возможность с помощью ПЦР не только обнаруживать присутствие вируса гепатита С, но и также проводить расшифровку его вида, выбирая наиболее эффективный способ лечения.

Оглавление:

к оглавлению ↑

Периоды течения болезни и результаты лабораторного обследования

Инкубационная стадия продолжается обычно 6-8 нед. (от 2-4-х недель вплоть до полугода и дольше). В данный период фиксируется первый пик увеличения аминотрансфераз. Синтез иммуноглобулинов начинается нанеделю от начала заболевания. Специфические иммуноглобулины класса М выявляются на месяц раньше, чем антитела класса G. Благодаря ПЦР можно обнаружить RNA-HCV уже на первых неделях заболевания.

Признаки острого периода:

  • присутствие «контрольной точки» согласно сведениям анамнеза;
  • выявление специфических антител класса М и возрастание их титра в динамике;
  • впервые выявленный острый гепатит;
  • увеличение содержания аминотрансфераз;
  • установление HCV-RNA.

Признаки течения вирусного гепатита С с положительным прогнозом:


  • раннее снижение концентрации антител класса М;
  • зафиксированная острая стадия в анамнезе;
  • отсутствие жалоб;
  • устойчивое отсутствие HVC-RNA;
  • длительная циркуляция специфических антител к структурным белкам.

Желтуха считается благоприятным признаком при протекании вирусного гепатита, а обнаружение специфических антител класса М в течение более двух месяцев — нехорошим, подтверждающим развитие хронической формы заболевания.

Скрытая стадия

Эта стадия соответствует затяжной персистенции вирусного гепатита С. Данная фаза сопровождается невыраженной симптоматикой либо ее полным отсутствием. Способна протекать в течение многих лет (как правило,лет).

Немаловажно выделить факт значительного различия в затяжном течении вирусного гепатита В и гепатита С. Предстадией для фазы реактивации гепатита С считается скрытая фаза течения, при этом формируется симптоматика, соответствующая затяжному течению гепатита.

Следует отметить, что хроническое течение гепатита В почти никогда ни приводит к обострению инфекционного процесса.

Совет от гепатологов

В 2012 году произошёл прорыв в лечении гепатита C. Были разработаны новые противовирусные препараты прямого действия, которые с вероятностью 97% полностью избавляют вас от заболевания. С этого момента гепатит С официально считается полностью излечимым заболеванием в медицинском сообществе. В Российской Федерации и странах СНГ препараты представлены марками софосбувир, даклатасвир и ледипасвир. В настоящий момент на рынке появилось очень много подделок. Лекарства надлежащего качества можно приобрести только у компаний, имеющих лицензии и соответствующую документацию.

Признаки скрытой стадии:

  • отсутствие жалоб;
  • зафиксированные указания на острый процесс в анамнезе;
  • наличие специфических антител класса G, а также антител к С-белку и к неструктурным протеинам;
  • увеличение титра печеночных ферментов;
  • анти-HCV-IgM и HCV-RNA не выявляются или обнаруживаются в невысоких концентрациях на период обострения заболевания.

к оглавлению ↑

Стадия реактивации

Существенным аспектом в анализе хронического течения вирусного гепатита С считается динамическое наблюдение специфическими антителами класса М. Они фиксируют фазу обострения.

Критерии перехода в стадию реактивации:


  • регулярное выявление высоких цифр антител класса G к структурным и неструктурным протеинам;
  • зафиксированная острая стадия в анамнезе;
  • увеличение содержания аминотрансфераз в крови;
  • выявление высокого уровня анти-HCV IgM;
  • обнаружение HCV-RNA;
  • появление симптоматики, которая свойственна хроническому течению болезни.

Источник: http://vsepropechen.ru/bolezni/gepatit/vidy/c/markery-gepatita-c.html

Вопросы

Вопрос: Гепатит с расшифровать анализ?

Здравствуйте,сдала анализ на антитела гепатита с,пришел ответ,подскажите,что он означает. Результат Референтные значения Оборудование

Антитела к вирусу гепатита С (анти-HCV) сумм. ПОЛОЖИТЕЛЬНЫЙ отрицательный

Название теста Результат Ед.изм Референтные значения

Подтверждающий тест на антитела к вирусу гепатита С ПОЛОЖИТЕЛЬНЫЙ отрицательный

Название теста Результат Ед.изм Референтные значения



NS3 (неструктурный белок) отрицательный отрицательный

NS4 (неструктурный белок) отрицательный отрицательный

NS5 (неструктурный белок) отрицательный отрицательный

Core (структурный белок) ПОЛОЖИТЕЛЬНЫЙ отрицательный

Результат анализа может быть расценен как положительный, но для получения точного ответа на этот вопрос, Вам необходимо лично проконсультироваться с инфекционистом.



Название теста Результат Референтные значения Оборудование

Антитела к вирусу гепатита С (анти-HCV) сумм. ПОЛОЖИТЕЛЬНЫЙ отрицательный

Название теста Результат Ед.изм Референтные значения

Подтверждающий тест на антитела к вирусу гепатита С ПОЛОЖИТЕЛЬНЫЙ отрицательный

Название теста Результат Ед.изм Референтные значения

NS3 (неструктурный белок) ПОЛОЖИТЕЛЬНЫЙ отрицательный



NS4 (неструктурный белок) отрицательный отрицательный

NS5 (неструктурный белок) отрицательный отрицательный

Core (структурный белок) ПОЛОЖИТЕЛЬНЫЙ отрицательный

Полученные результаты обследования свидетельствуют о наличии у вас вируса гепатита С. В данном случае, рекомендуется проконсультироваться с врачом гепатологом, для решения вопроса о необходимости проведения адекватного лечения. Так же необходимо сдать биохимический анализ крови, для определения функции печени. Подробнее о данном заболевании, методах диагностики и лечения, читайте в цикле статей перейдя по ссылке: Гепатит С.

Подскажите что это значит по анализам?



Результат Референтные значения Оборудование

Антитела к вирусу гепатита С (анти-HCV) IgM отрицательный отрицательный

Антитела к вирусу гепатита С (анти-HCV) сумм. ПОЛОЖИТЕЛЬНЫЙ отрицательный

Результат Ед.изм Референтные значения

Антитела к вирусу гепатита С (анти-HCV) IgM отрицательный отрицательный

Антитела к вирусу гепатита С (анти-HCV) сумм. ПОЛОЖИТЕЛЬНЫЙ отрицательный



Полученные результаты обследования указывают на хроническое течение гепатита С. Рекомендуется проконсультироваться с врачом гепатологом, для проведения комплексного обследования и назначения при необходимости адекватного лечения. Подробнее о данном заболевании и методах диагностики, читайте в цикле статей перейдя по ссылке: Гепатит С.

Спасибо за ответ.

Но мне не понятно почему хроническое течение гепатита С.

Если результаты исследования подтверждают наличие вирусного гепатита С. Однако, инфекция находится в состоянии ремиссии учитывая показатели Ig M — отрицательно. Окончательную оценку состоянии возможно провести после проведения ПЦР анализа крови на РНК вируса гепатита С и проведения генотипирования гепатитата С с количественным анализом на гепатит С.

Ремиссия вирусного гепатита С — это состояние заболевания когда вирусные частицы либо отсутствуют в крови, находясь внутри печеночных клеток, либо полностью отсутствуют в крови и в печеночных клетках



При ремиссии передача половым путем исключается ввиду низкой концентрации или отсутствия вируса гепатита С в крови.

P.S С 4 декабря 2012г по 14 декабря 2012г я лежала с отравлением в токсикологии. (отравление газом) и у меня вообще такое предположение что мне там могли внести гепатит С,Я думаю мне не надо разъяснять что такое лежать в токсикологии в муниципальной больнице .

Спасибо за ранее .

Вы абсолютно правы, но понятие здорового носительства в медицине нет. Ваш клинический диагноз будет звучать, таким образом: Хронический гепатит С, низкая вирусная нагрузка, стадия ремиссии, с или без нарушения функции печени. При условии, если действительно вирусная нагрузка будет низкая. По этому, рекомендуется провести дополнительные методы обследования, для уточнения диагноза и при необходимости проведения адекватного лечения: противовирусного или симптоматического. Подробнее о данном заболевании и методах диагностики, читайте в цикле статей перейдя по ссылке: Гепатит С.

сдала анализ на гепатиты,пришел полож гепатит С,core отриц.,NS-6,9.что это значит



В данной ситуации очень важно сравнение результатов в динамике, так как значение такого показателя, как NS свидетельствует о наступлении ремиссии, адекватной реакции на проводимую терапию. Рекомендую Вам лично проконсультироваться с врачом инфекционистом. Подробнее по данному вопросу Вы можете получить информацию в тематическом разделе нашего сайта: Гепатит С

День добрый! О чем свидетельствуют следующие анализы?

NS4 — результат: ПОЛОЖИТЕЛЬНЫЙ — референтные значения: ОТРИЦАТЕЛЬНЫЙ

NS5 — результат: ОТРИЦАТЕЛЬНЫЙ — референтные значения: ОТРИЦАТЕЛЬНЫЙ

Core — результат: ПОЛОЖИТЕЛЬНЫЙ — референтные значения: ОТРИЦАТЕЛЬНЫЙ



Данный анализ свидетельствует о том, что у Вас обнаружен гепатит С. Рекомендую Вам лично проконсультироваться с врачом гепатологом, который сможет определить дальнейшую тактику динамического наблюдения и лечения (при наличии необходимости). Подробнее по данному вопросу читайте в тематическом разделе: Вирусный гепатит С

Добрый день ! Помогите пожалуйста разобраться с анализом.

Я беременна — 12 недель. В ж/к сдала анализ anti — HCV — пришли положительные , врач сказала такое бывает у беременных и отправила на пересдачу , пересдала получила результат anti-HCV- отрицательн.

ПЦР исследования — PHK вируса гепатита С — не обнаружены.

Подтверждающий тест на антитела к вирусу гепатита С

Биохимия — Билируб- 3.



В данном случае результат сомнительный, с большей вероятностью, что вирусного гепатита С у Вас никогда не было. Рекомендую Вам повторное обследование спустя 1,5-2 месяца, лечение и профилактика в настоящее время Вас не нужны. Подробнее по интересующему Вас вопросу читайте в разделе нашего сайта: Гепатит С

Добрый вечер! !! у ребенка положительные антитела гепатит с в 3 месяца и в 6 месяцев! !! значит ребенок болеет гепатитом?

Получение положительных результатов означает, что ребенок инфицирован вирусным гепатитом В. В данной ситуации Вам необходимо сдать дополнительно анализы, чтобы определить вирусную нагрузку, биохимический анализ крови (печеночные пробы) и лично посетить врача гепатолога, который назначит адекватное профилактическое лечение. Об этом подробнее читайте в разделе нашего сайта: Гепатит

Здравствуйте. Впервые обнаружили Анти-HCV total в 2010 году. Меня направили в Гепатологический Центр при Инфекционной Клинической Больнице №1 на Волоколамском шоссе. При обследовании Анти-HCV total и РНК не было обнаружено. В выписке указали что Гепатитом С я не болела. Сейчас у меня беременность 32 недели, месяц назад сдала Анти-HCV total и показало положительно. Я сразу сдала РНК который показал отрицательно. Сдала повторно 2 неделе назад Анти-HCV total показало ОТРИЦАТЕЛЬНО. Врач гинеколог направила на анализ инфекционная серология (Скрининг). Сегодня получила анализы Аnti-HCV (core)- 1.7, а Анти-HCV (NS3,NS4 и NS5-отрицательно. Гинеколог сказала что (core)- 1.7 это очень маленькая цифра и не понятно болела я или нет. И указала в обменной карте Анти-HCV total (сомнительно). Прошу Вас помогите разобраться был ли он у меня я или нет?

В данной ситуации результат сомнительный, что может означать: Вы перенесли заболевание ранее в легкой форме, а вирусная нагрузка в настоящее время чрезвычайно мала. Более подробно по данному вопросу читайте в тематическом цикле статей нашего сайта, перейдя по ссылке: Вирусный гепатит С

День добрый, получил анализы на гепатит вот с такими результатами (HBsAg-отр) (анти ВГС core +) и (NS+) что они значат ,и что мне делать дальше? спасибо.



Данное заключение означает, что Вы ранее перенесли вирусный гепатит С. Вам необходимо лично посетить врача гепатолога, сделать биохимический анализ крови, печеночные пробы, УЗИ внутренних органов, на основании чего лечащий врач сможет определить необходимость лечения. Вы можете получить более подробную информацию по интересующему Вас вопросу в тематическом разделе нашего сайта, перейдя по следующей ссылке: Вирусный гепатит С — диагностика и профилактика

Спасибо большое за быстрый ответ, я вот смогу только через месяц обратиться к врачу и я так понял что если я перенес Гепатит С ранее то я сейчас им болею на 100% , вот этот месяц (до) врача гепатолога посоветуйте лекарство какое можно мне принимать для профилактики что ли? я слышал что фосфоглив вроде хорошее лекаство можно его пить или что нибудь другое что посоветуете ?

Для назначения лечения в случае необходимости Вам следует первоначально пройти обследование, установить состояние печени, после чего лечащий врач сможет Вам дать рекомендации. Получить более подробную информацию по интересующему Вас вопросу Вы можете в соответствующем разделе нашего сайта, перейдя по следующей ссылке: Лечение гепатита С

Здравствуйте. У мужа обнаружили гепатитС.Отправили к гепатологу, но у нас нет такого врача.Помогите расшифровать анализы, а то голова болит от думок, что делать.

Источник: http://www.tiensmed.ru/news/answers/gepatit-s-rasshifrovat-analiz.html



набор антигенов для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита с

G01N33/68 с использованием протеинов, пептидов или аминокислот

G01N33/53 иммунологический анализ, анализ биоспецифического связывания, материалы для этого

Изобретение относится к диагностическим средствам медицинского назначения, и касается набора для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита С. Сущность изобретения состоит в том, что с целью оптимизации композиции антигенов в набор включены в качестве антигенов полипептиды, одновременно содержащие эпитопы, характерные для большинства генотипов вируса гепатита С. Использование набора антигенов обеспечивает высокие показатели специфичности. 2 ил.

Рисунки к патенту РФ

Изобретение относится к диагностическим средствам медицинского назначения, применяемым в диагностических лабораториях и банках крови с целью выявления антител к структурным и неструктурным белкам вируса гепатита C, направленного на определение ложноположительных результатов твердофазного иммуноферментного анализа в ходе первичного скрининга на наличие антител к вирусу гепатита C.

Для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита C (ВГС) применяются в качестве подтверждающих следующие тест-системы: CHIRON RIBA HCV 3.0 (Chiron Corporation, USA), Deciscan anti-HCV (Bio Rad), INNO-LIA HCV Ab III update (Innogenetics).



Все указанные выше тест-системы выполнены в формате иммуноблота. Наиболее близкими аналогами настоящего изобретения являются набор антигенов для определения антител к вирусу гепатита C «ДС-НСV-Антигены», разработанный ООО НПО «Диагностические системы» (патент RUC1), и тест-система фирмы Innogenetics. В состав последней тест-системы, согласно Cramp ME Hepatitis C virus (HCV) specific immune responses in anti-HCV positive patients without hepatitis C viraemia. Gut. 1999 Mar; 44 (3): 424-9, в качестве антигенов включены следующие компоненты.

— Core: аминокислоты 1-32 и 31-74

— NS4: аминокислоты и

— NS5: аминокислоты

— Е2: аминокислоты

— NS3: аминокислоты

Как и в настоящем изобретении, в последовательностях, представляющих белки Core и NS3, представлены иммуногенные детерминанты, являющиеся общими для всех генотипов вируса гепатита C. Однако последовательности, представляющие белок NS4, не содержат иммуногенных детерминант, характерных для генотипов 2 и 5 вируса гепатита C, а последовательность аминокислот, представляющая белок NS5, содержит имуногенные детерминанты, характерные только для генотипа 1. В определенных случаях этот недостаток может существенным образом повлиять на специфичность тест-системы.

Целью настоящего изобретения является повышение специфичности подтверждающего теста на основе иммуноблота для выявления антител к структурным и неструктурным белкам вируса гепатита C в сыворотке крови.

Сущность изобретения как технического решения. Важной особенностью ВГС является его генетическая неоднородность. Особенно много субтипов ВГС регистрируется в Африке и Юго-Восточной Азии. Считается, что для клинической практики достаточно разграничивать 5 субтипов ВГС: 1a, 1b, 2a, 2b, 3a (Zein N.N., Persing D.H., 1996). Установлены существенные географические различия в распространении разных генотипов. Так, в Японии, на Тайване, частично в Китае, регистрируются преимущественно генотипы 1b, 2a, 2b. В США преобладает 1a генотип. В Европейских странах преобладает генотип ВГС 1a, в Южной Европе заметно возрастает доля генотипа 1b. В России чаще регистрируется генотип ВГС 1b, далее с убывающей частотой — 3a, 1a, 2a.

Международная практика предусматривает в качестве тестов первичного обследования и скрининга определение антител к ВГС. В тест-системах последнего поколения в качестве антигенов используется смесь рекомбинантных и синтетических фрагментов структурных и неструктурных белков вируса гепатита C (core, NS3, NS4, NS5). Положительные и сомнительные результаты первичного серологического исследования на наличие антител к гепатиту C должны быть проверены другим, более специфичным (подтверждающим) серологическим исследованием или определением вирусной РНК. В основе подтверждающего серологического теста должно лежать раздельное выявление антител к белкам вируса гепатита C.

Таким образом, чувствительный и специфичный подтверждающий тест должен выявлять антитела к разным белкам вируса гепатита C генотипов 1, 2, 3, 4, 5 и 6 в широком диапазоне концентраций и отсеивать ложноположительные результаты первичного скрининга на антитела к ВГС. При положительном результате первичного скрининга методом иммуноферментного анализа, его проводят еще два раза. Если хотя бы в одном из повторных определений результат будет положительным, общий результат считается положительным. Иммуноферментный анализ обеспечивает специфичность не менее 99%. Однако, в группах с низкой частотой носительства, даже при столь высокой специфичности ложноположительных результатов оказывается слишком много. Среди лиц со сниженным иммунитетом (например, у больных на гемодиализе), доля ложноположительных результатов составляет около 15%. Среди лиц с сохранным иммунитетом и частотой носительства менее 10% (доноры, военнослужащие, работники здравоохранения, больные венерологических лечебных учреждений) эта доля еще выше — в среднем 35%. Следовательно, целиком полагаться на первичное определение нельзя. Это не более чем предварительный результат, который необходимо подтвердить более специфичным методом. В качестве подтверждающего метода используют еще один серологический метод — иммуноблоттинг с рекомбинантными и синтетическими вирусными антигенами. Отрицательный результат иммуноблоттинга говорит об отсутствии антител к вирусу гепатита C. Результат первичного определения в этом случае считается ложноположительным, обследованному о нем не сообщают.

Целевое назначение настоящего изобретения (повышение специфичности подтверждающего теста на основе иммуноблота для выявления антител к структурным и неструктурным белкам вируса гепатита C в сыворотке крови) реализовано следующим образом: каждый антиген, используемый в составе тест-системы, а именно рекомбинантные белки, содержащие иммунодоминантные регионы неструктурных белков ВГС NS3, NS4 и NS5 и структурного белка core, представлены аминокислотными последовательностями, содержащими одновременно иммуногенные детерминанты, характерные для различных генотипов вируса гепатита C. Повышение специфичности в этом случае происходит за счет увеличения «удельного веса» иммунодоминантных регионов в антигене.

Выявление участков, содержащих иммуногенные детерминанты, характерные для всех / большинства генотипов вируса гепатита C, было выполнено in silico с применением следующих информационных ресурсов:

1. HCV immunology database: База иммунологических данных по вирусу гепатита C (http://hcv.lanl.gov/content/immuno/immuno-main.html). С помощью этой базы данных были выявлены все возможные эпитопы структурных и неструктурных белков вируса гепатита C.

2. HCV sequence database / HCV BLAST search: База данных сиквенса вируса гепатита C / Программа поиска похожих последовательностей (http://hcv.lanl.gov/content/sequence/BASIC_BLAST/basic_blast.html). С помощью этих базы данных и программы были выявлены эпитопы, общие для большинства генотипов вируса гепатита C, и найдены последовательности с наиболее высокой плотностью таких эпитопов.

Выявленные для каждого антигена последовательности аминокислот с наибольшей плотностью общих для всех (большинства в случае NS5 антигена) генотипов вируса гепатита C представлены на фиг.1. Подчеркнутые участки являются наилучшими антигенами для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита C.

Краткое описание чертежей

На фиг.1А показана аминокислотная последовательность (аминокислоты с 1 по 191) белка core. Подчеркнутые участки содержат иммуногенные детерминанты, представленные во всех генотипах вируса гепатита C.

На фиг.1В показан участок аминокислотной последовательности (аминокислоты с 1192 по 1459) белка NS3. Подчеркнутые участки содержат иммуногенные детерминанты, представленные в 1, 2, 4, 5 и 6 генотипах вируса гепатита C; более крупным, жирным шрифтом выделены иммуногенные участки, представленные во всех генотипах вируса гепатита C.

На фиг.1C показан участок аминокислотной последовательности (аминокислоты с 1676 по 1947) белка NS4. Подчеркнутые участки содержат иммуногенные детерминанты, представленные во всех генотипах вируса гепатита C.

На фиг.1D показан участок аминокислотной последовательности (аминокислоты с 2691 по 2830) белка NS5. Подчеркнутые участки содержат иммуногенные детерминанты, представленные в 1, 2, 3 и 6 генотипах вируса гепатита C.

Раздельное определение антител к белкам вируса гепатита C с помощью разработанного набора антигенов осуществляется в описанной ниже последовательности.

Для анализа используется нитроцеллюлозная мембрана с адсорбированными в виде отдельных полос антигенами.

Образец (плазма или сыворотка) инкубируется с мембраной. Взаимодействие антител с антигенами проявляется с помощью меченных ферментом антител против IgG человека с последующей детекцией при помощи субстратного комплекса.

Для контроля успешного прохождения реакции на каждую полоску наносится античеловеческий иммуноглобулин (контрольная полоска «Уровень 2+» на фиг.2), для контроля нижней границы положительной реакции на полоску наносится иммуноглобулин человека (контрольная полоска «Уровень 1+» на фиг.2).

Оценка результатов производится визуально по представленной ниже методике. Параллельно с каждой серией исследуемых образцов исследуется отрицательная сыворотка и положительная сыворотка. Исследование считается успешным в случае одновременного выполнения следующих условий:

— полоска, инкубированная с отрицательной сывороткой, должна показать окрашивание только полос контроля прохождения реакции;

— полоска, инкубированная с положительной сывороткой, должна показать четкое окрашивание полос положительного контроля и антигенов. В случае успешного протекания всех контрольных реакций исследуемые образцы сравниваются с контрольными и оцениваются как положительные, отрицательные или неопределенные. Для получения достоверного результата все положительные образцы необходимо протестировать еще раз. В случае неопределенного результата через четыре недели необходимо провести анализ новых образцов крови пациента.

Положительным считается результат, показавший две или больше полоски с интенсивностью окраски +1 и больше.

Неопределенным считается результат, показавший только одну полоску с интенсивностью окрашивания +1 и больше.

ФОРМУЛА ИЗОБРЕТЕНИЯ

Набор для раздельного выявления антител к структурным (core) и неструктурным (NS3, NS4, NS5) белкам вируса гепатита С, включающий комбинацию содержащих иммуноактивные эпитопы структурных и неструктурных антигенов вируса гепатита С, иммобилизованных на поверхности твердофазного носителя, отличающийся тем, что в качестве антигенов включает следующие полипептиды:

HCV Core: RRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRAT

HCV Core: RRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGV

HCV NS 3: KVPAAYAAQGYKVLVLNPSVAAT

HCV NS 3: ITYSTYGKFLADGGCSGGAY

HCV NS 4: NFISGIQYLAGLSTLPGNPAIASL

HCV NS 4: EGAVQWMNRLIAFASRGNHVSPTHY

HCV NS 5: GYRRCRASGVLT HCV NS 5: RDPTTPLARAAWETAR.

Источник: http://www.freepatent.ru/patents/

Hepatitis C virus (HCV, гепатит C), структурные и неструктурные белки, антитела, качественный, кровь

Гепатит С — инфекционное заболевание, вызванное РНК вирусом гепатита С. Существует шесть генотипов вируса гепатита С, которые разделены на подтипы.

Гепатит С характеризуется воспалением и повреждением печени. Инфекция гепатита С часто протекает безсимптомно, но хроническое течение заболевания может привести к циррозу печени. В некоторых случаях возможно развитие рака печени и опасного для жизни варикозного расширения вен пищевода и желудка.

Околомиллионов человек заражены гепатитом С. Гепатит С — причина 27% случаев цирроза печени и 25% случаев гепатоцеллюлярной карциномы (рака печени).

Основной путь передачи инфекции в развитых странах — внутривенное употребление наркотиков. В развивающихся странах вирус передается чаще при переливании крови и медицинских процедурах, а также при татуаже. В 20% случаев причина заражения остается невыясненной. Возможные пути передачи гепатита С — пересадка органов и костного мозга, вертикальный путь — от матери ребенку во время родов. В редких случаях гепатит С может передаваться при незащищенных половых контактах, а также совместном использовании средств личной гигиены (бритва, зубная щетка).

Гепатит С сопровождается острой симптоматикой лишь в 15% случаев. Проявления, как правило, мягкие — снижение веса, потеря аппетита, тошнота, мышечные боли, боли в суставах, усталость. У приблизительно 85% инфицированных заболевание переходит в хроническую форму. Обычно хронический гепатит С протекает без клинических проявлений в течение первых десяти лет. Жировые изменения в печени наблюдаются примерно у 50% больных и определяются перед развитием цирроза.

Распространенность гепатита С у иммунокомпрометированных лиц гораздо выше, чем у здоровых людей. Гепатит С у ВИЧ-инфицированных, реципиентов органов, а также при гипогаммаглобулинемии (снижении уровня иммуноглобулинов) отличается быстрым течением и переходом в цирроз печени.

Предполагается, что 5-50% инфицированных вирусом гепатита С не знают о своем статусе. Тестирование рекомендовано группам риска — лицам, употребляющим внутривенные наркотики, а также реципиентам крови (обязательно в случае гемотрансфузии, проведенной до 1992 года,) и лицам, имеющим татуировки. Скрининг также рекомендован при повышении уровня печеночных трансаминаз.

При инфицировании вирусом гепатита С синтезируются антитела к нескольким антигенам вируса. Через 6-8 недель после инфицирования вырабатываются иммуноглобулины к структурным белкам вируса гепатита С, к которым относится сердцевинный core-антиген. Позже, в течение нескольких недель после выработки первых антител, в крови появляются антитела к неструктурным белкам — NS2, NS3, NS4, NS5. Выявление антител сразу к нескольким антигенам вируса гепатита С повышает диагностическую ценность метода.

Данный анализ позволяет выявить антитела к структурным и неструктурным белкам вируса гепатита С. Анализ помогает диагностировать гепатит С.

Метод

Иммуно-ферментный анализа — ИФА

Референсные значения — норма

(Hepatitis C virus (HCV, гепатит C), структурные и неструктурные белки, антитела, качественный, кровь)

Информация, касающаяся референсных значений показателей, а также сам состав входящих в анализ показателей может несколько отличаться в зависимости от лаборатории!

Источник: http://www.analizmarket.ru/tests/id/4536

/ Тема 7

При исследованиях пептида, состоящего из последователь­ности УЗ и эпитопа р24Е, был получен иммунный гуморальный ответ у ряда животных.

Использование синтетических пептидов в качестве вакцин против ВИЧ-инфекции находится в стадии изучения. В настоя­щее время не удалось индуцировать выработку одновременно как гуморального, так и клеточного ответа. Проблема нуждается в дальнейшей разработке.

Антиидиотипические вакцины. Антиидиотипические антитела можно использовать в качестве вакцин, обладающих структур­ной мимикрией антигена к антиидиотипическим антителам. Так, приматы, иммунизированные человеческими антиидиотипичес- кими моноклональными антителами, продуцируют низкие тит­ры нейтрализующих антител к ВИЧ-1. Однако до настоящего времени остаются сомнения, может ли такой принцип лечь в ос­нову создания вакцин против ВИЧ-инфекции.

ДНК-вакцины. Введение в мышцы или эпидермис животного очищенной ДНК-плазмиды, несущей ген, кодирующий соответ­ствующие антигены, приводит к экспрессии соответствующего антигена непосредственно клетками млекопитающих. При этом наиболее выраженным оказывается Т-клеточный ответ. Приме­нение ДНК-вакцин имеет ряд преимуществ: простоту и легкость приготовления, химическую стабильность. Вакцинация ДНК ВИЧ-1 вакциной может быть усилена бустерными дозами субъе- диничных вакцин на основе £р!20, §р160 p24gag, также способ­ствующих выработке Т-клеточного иммунитета. В настоящее время начаты попытки иммунизировать макак ДН К-вакцинами. Однако эти попытки до настоящего времени не увенчались успе­хом. Вопрос нуждается в дальнейшем изучении.

Важным шагом на пути к созданию отечественной вакцины против ВИЧ/СПИД стала утвержденная в 1997 г. Министерством науки РФ межведомственная научно-техническая программа «Вакцины нового поколения и медицинские диагностические системы будущего» (руководитель — вице-президент РАН акад. Р.В. Петров), в которой предусмотрен раздел, посвященный вак­цине против ВИЧ/СПИД.

В рамках программы определены основные направления в об­ласти создания вакцин, к которым относятся изучение генетичес­кого разнообразия, особенностей структуры и биологических свойств отечественных изолятов ВИЧ; разработка перспективных антигенов различной природы, средств доставки и адъювантов; биологические и клинические испытания перспективных вакцин.

Следует отметить, что ни одна исследовательская работа по созданию вакцины против ВИЧ не доведена до создания эффек­тивного препарата и его испытания на добровольцах.

Пожалуй, наиболее приблизилась к окончательному успеху фирма «Пастер Мерье Коннот*- (Франция). В настоящее время проводятся клинические испытания векторной вакцины АЬУАС среди ВИЧ-негативных взрослых в Африке (Уганда). АЬУАС сос­тоит из вируса Сапагурох, генетически измененного для экспрес­сии белков, которые несет на себе и ВИЧ. Одним из них являет­ся поверхностный белок вируса ^р120, другие два — Gag-пpoтeин и протеаза. Во 2-й и 3-й фазах испытаний АЬУАС показала хоро­шую безопасность и иммуногенность в исследованиях на 800 добровольцах во Франции и США. Исследование в Уганде приз­вано определить, является ли вакцина иммуногенной у предста­вителей негроидной расы в такой же мере, как и у европеоидов. АЬУАС основана на штаммах ВИЧ, выделенных в странах Запа­да. Однако, как показали ранние исследования, она может сти­мулировать клеточный иммунитет и к другим штаммам вирусов, распространенных в Африке.

АЬУАС была разработана при поддержке £N1*5 Французского национального Агентства по исследованиям СПИДа. Исследова­ние поддержано Национальным институтом аллергических и ин­фекционных заболеваний >11АШ (США) и Объединенной прог­раммой ООН по ВИЧ/СПИД (Ь^АШЭ).

Гепатит С — преимущественно хроническое заболевание пече­ни, вызываемое одним из представителей семейства флавивирусов.

В структуре острых вирусных гепатитов у детей доля гепатита С составляет 1,5%, хронических гепатитов — 40%, а среди гепати­тов, возникающих у детей с соматической патологией (гемоблас- тозы, солидные опухоли и др.) — 50%. По официальной статисти­ке, общая заболеваемость гепатитом С в 1994 г. составила 3,2 нанаселения, в 1995 г. — 6,8, в 1997 г. — 9,1, а в 1998 г. — 11,6, то есть она увеличивалась ежегодно в арифметической прогрес­сии. Однако с 2002 г. заболеваемость стала снижаться и составила в 2003 г. 5,24, а в 2004 г. — 4,8. В Западной Европе и США на долю гепатита С приходится до 95% всех случаев посттрансфузионного и парентерального гепатита, кроме того, в США, например, анти­тела к вирусу гепатита С (ВГС) обнаруживаются у 1,4% представи­телей общей популяции, и у 0,1—0,7% здоровых доноров. Еще больше распространенность вируса в развивающихся странах, в отдельных популяциях Африки, Ближнего и Среднего Востока, а также Средней Азии она достигает 4—6%.

ВГС передается исключительно парентеральным путем, преи­мущественно с препаратами крови и в ходе различных инвазивных вмешательств, в том числе и через микротравмы, при бытовом контакте. РНК ВГС обнаружена в слюне, моче, семенной и асци­тической жидкости. Факторами риска ВГС-инфекции следует считать любое внутривенное введение лекарств или наркотиков, а также гемодиализ, татуировки, пересадку органов и тканей. Опи- сана передача ВГС при внутривенном введении интерферонов, не­редко заражение происходит во время лечения зубов, при маникю­ре, взятии крови на исследование, гастроскопии и др. Однако у 20—30% всех больных путь передачи вируса остается неизвестным.

«Вертикальная» передача ВГС (от матери младенцу) осуществля­ется редко, она возможна при высоких титрах вируса у матери, или при прохождении по родовым путям в результате попадания вирус­содержащего материала в поврежденные кожные покровы ребенка.

Клинические проявления острого гепатита С слабо выраже­ны. У большинства инфицированных заболевание остается бес­симптомным, желтуха возникает только у 20—30% больных, обычно с трансфузионным заражением. Более постоянными симптомами бывают вялость, недомогание, реже тошнота, рвота, субфебрильная температура, боль в животе. При манифестных формах умеренно увеличена и уплотнена печень, реже селезенка. В сыворотке крови у всех больных возрастает активность Ал Ат и Ас АТ, возможно снижение протромбина, повышение результатов тимоловой пробы и явления диспротеинемии.

Гепатит С склонен к хронизации. Острое течение отмечается у 20% больных, у остальных формируется хронический гепатит по типу первичного. Болезнь долго остается малосимптомной или да­же бессимптомной. Поданным М. Tang и соавт. (1995), средний пе­риод от заражения ВГС до развития хронического гепатита, цирро­за и гепатоцеллюлярной карциномы составил 18,4; 20,6 и 28,3 года соответственно. За время наблюдения 19 (14,5%) больных умерли от осложнений цирроза или гепатоцеллюлярной карциномы.

В детском возрасте тяжелые последствия гепатита С встреча­ются значительно чаще, чем других форм вирусного гепатита. По нашим данным, выраженный фиброз печени выявляется у 29% больных хроническим гепатитом С, а цирроз — в 4,5%. Выражен­ного цирроза и фиброза не наблюдали ни у одного больного хро­ническим гепатитом В в аналогичные сроки.

Исследование препаратов крови на ВГС существенно не пов­лияло на общую заболеваемость. Более того, в последние годы обнаруживается рост числа заболевших в связи с эпидемией нар­комании. Эффективно бороться с гепатитом С можно только пу­тем вакцинопрофилактики.

Современные подходы к созданию вакцины против гепатита С.

ВГ С имеет 3 структурных гена, названных С, El и Е2.

Источник: http://studfiles.net/preview//page:2/

Вирусы гепатитов B и C, Hepatitis C virus, Hepatitis B virus

Вирусы гепатитов поражают прежде всего печень, почему болезнь и получила своё название : hepatitis (лат.) — воспаление печени . Путь передачи обоих вирусов — парентеральный, то есть через кровь и половым путём. Если раньше самой распространённой причиной заражения было переливание крови, то в настоящее время инфицирование чаще всего происходит в группах высокого риска (проститутки, наркоманы).

Какой из гепатитов опаснее — В или С? Ответить можно только по-одесски — оба.

Гепатит В встречается гораздо чаще протекает более остро, но чаще всего заканчивается без осложнений. Последнее мало утешает те 10% больных, у которых болезнь переходит в хроническое течение, а при хроническом гепатите, в свою очередь, в 1 % случаев развивается цирроз и первичный рак печени.

Гепатит С называют «убийцей с мягкими лапами». Протекая не столь остро, как гепатит В, он переходит в хронический процесс в 30-70% случаев. Цирроз печени развивается у 10-30% больных, велик процент первичного рака печени.

Рис.1 Расспространенность гепатита С

Специфического лечения гепатитов не существует, терапия интерфероном (при гепатите С), крайне дорогостояща и недостаточно эффективна.

Вирус гепатита С

Вирус гепатита С содержит однонитевую РНК и относится к семейству флавивирусов. Электроннооптических изображений вируса гепатита С не существует, это связано с низким содержанием вируса в крови. По понятным причинам не может быть и фотографий, сделанных с помощью светового микроскопа. Вирус идентифицирован и охарактеризован молекулярно-биологическими методами.

Однонитевая РНК вируса содержит около 10.000 нуклеотидов. Идентифицированы три структурных белка: структурный белок нуклеокапсида (белок C), а также — мембранный (белок М) и поверхностный (белок E). Белки обладают сходными антигенными свойствами, поэтому их общим маркером являются иммуноглобулины анти-HCV-core-Ig . Выделены также 5 неструктурных (NS) белков, принимающие участие в репликации вируса.

Диагностика гепатита C


Обнаружение антигена .

Непосредственное обнаружение антигена в крови не представляется возможным. Это обусловлено малым количеством вирусных частиц в сыворотке больного, не превышающим 10 5 /мл, что ниже предела чувствительности иммунологических методов.

Антитела .

В скрининговых исследованиях используют метод ИФА для определения суммарных (IgM+IgG) анти-HCV или анти-HCV класса IgG. В качестве подтверждающих тестов применяют иммуноблот на основе рекомбинантных и синтетических пептидов. Для уточнения стадии заболевания существуют тест-системы для определения анти-HCV класса IgM, а также анти-NS-IgG (антитела к не-структурным белкам) . В типичных случаях анти-HCV появляются в конце инфекционного процесса, т.е. черезмес. после заражения. Однако, в некоторых случаях антитела обнаруживались уже нанеделе после переливания заражённой крови , а в других случаях сероконверсия происходила через год после заражения . В соответствии с тенденцией гепатита С к хронизации — антитела обнаруживаются в течение длительного периода. Учитывая задержку в выработке антител, отрицательный результат исследования на анти-HCV не исключает инфекционности сыворотки. В то же время, все сыворотки, в которых была обнаружена РНК вируса гепатита С, оказались «заразными».

HCV-RNA (определение РНК вируса гепатита С ).

РНК вируса гепатита С может быть обнаружена в сыворотке крови или в биоптате печени с помощью ПЦР с обратной транскрипцией. Теоретически чувствительность ПЦР позволяет определить одну (!) вирусную частицу в пробе. Существующие в настоящее время тест-системы ПЦР позволяют не только выявлять наличие вируса гепатита С, но и устанавливать его тип, определяя тем самым тактику и прогноз лечения.

Фазы течения заболевания гепатитом С и результаты лабораторного исследования


Острая фаза

Инкубационный период длится в среднемнед. (отх недель до 4 -6 месяцев и более). В этот момент регистрируется первый пик повышения печёночных ферментов. Сероконверсия наступает черезнед. (варьирует от 5 до 50 недель) от момента заражения. Анти-HCV класса IgM обнаруживают нанедели раньше, чем анти-HCV класса IgG. РНК вируса с помощью ПЦР определяется черезнедели после инфицирования.

Критерии острой фазы:

наличие «точки отсчета» по данным эпиданамнеза:

синдром острого гепатита при отсутствии указаний на подобные заболевания в прошлом;

повышение уровня печеночных ферментов;

обнаружение анти-HCV-IgM и нарастание их титров при динамическом наблюдении:

выявление анти-HCV-core-IgG с нарастанием титров в динамике:

определение РНК ВГС.

Признаки благоприятного исхода острого гепатита С с выздоровлением

указание на острую стадию в анамнезе;

отсутствие клинических проявлений;

анти-HCV-IgM исчезают в ранние сроки;

регистрируется стойкое отсутствие РНК ВГС;

анти-HCV-IgG продолжают циркулировать в крови годы.

Желтуха является хорошим прогностическим признаком, а длительная циркуляция анти-HCV-IgM (более 2-х мес.) — плохим, свидетельствующим о возможной хронизации процесса.

Соответствует хроническому персистирующему гепатиту при полном или почти полном отсутствии клинических проявлений. Может продолжаться многие годы, в среднемлет. Важно отметить существенные отличия хронического носительства вирусного гепатита В (ВГВ) и вирусного гепатита С (ВГС). Латентная (скрытая) стадия ГС является предстадией фазы реактивации инфекционного процесса с развитием клинических проявлений хронического гепатита. В то время как хроническое носительство HBsAg (при отсутствии повторного инфицирования), крайне редко предшествует обострению хронического ГВ.

Критерии латентной фазы:

наличие в анамнезе указаний на острую стадию:

отсутствие клинических проявлении;

анти-HCV-IgG как к С-протеину, так и к неструктурным белкам (NS3 NS4, NS5 в высоких титрах

анти-HCV-IgM и РНК ВГС не обнаруживаются либо (учитывая характерную черту ВГС — «волнообразность) выявляются в низких концентрациях во время обострения инфекции;

во время обострения могут незначительно повышаться и уровни печёночных ферментов.

Важнейшим критерием оценки хронического ВГС является динамический контроль за анти-HCV IgM. Они всегда регистрируются в фазу обострении

Критерии перехода в фазу реактивации:

наличие в отдаленное анамнезе указаний на острую фазу

появление клинических признаков хронического гепатита,

повышение уровня печеночных ферментов,

закономерное обнаружение в высоких титрах анти-HCV IgG к core и NS.

обнаружение анти-HCV IgM преимущественно в высоких титрах

определение РНК ВГС

Типичные сочетания маркеров гепатита C и соответствующее клиническое значение (диагноз)

Интерпретация результатов ИФА

Возможно, острый гепатит С

2. Стадия перехода в ХГС (латентную фазу)

2. Латентная фаза ХГС

1. Обострение в латентную фазу ХГС

2. Фаза реактивации

Критерии разграничения фаз заболевания необходимо рассматривать только в совокупности и в динамике, так как близкие результаты разовых исследований могут соответствовать как острой, так и хронической стадии инфекционного процесса. Важное значение имеет предположительный учёт давности болезни.

Вспомогательные методы диагностики и контроля лечения гепатитов.

Печень выполняет в организме многочисленные задачи, она — «рекордсмен» по количеству выполняемых функций. Инфекционные гепатиты, нарушая функции печени, вызывают изменения практически всех лабораторных показателей состояния организма. Некоторые из этих изменений неспецифичны, т. е. возникают и при других заболеваниях. Есть и признаки, характерные именно для вирусных гепатитов (ВГ). Так, возникающее при ВГ массивное повреждение клеток печени — гепатоцитов — влечёт за собой выход в кровь содержащихся в этих клетках ферментов. Содержание аланиламинотрансферазы (АлАт) и аспартатаминотрансферазы (АсАт) при остром гепатите возрастает в крови в десятки раз, причём преобладает возрастание АлАт — это характерный признак гепатита. Активность аминотрансфераз увеличивается ещё до возникновения желтухи — пожелтения кожных покровов и слизистых, что делает выявление АлАт и АсАт ценным диагностическим признаком. Нарушается также т.н. пигментный обмен — возрастает количество билирубина (именно его избыток, откладываясь в тканях, и даёт желтушность). Следует отметить, что при вирусных гепатитах возрастает, в основном, содержание т.н. прямого билирубина; это отличает их от других заболеваний печени. В моче ещё в дожелтушном периоде увеличивается количество уробилиногена (которое легко определяется с помощью тест-полосок, что делает этот метод очень ценным для экспресс-диагностики в очагах вирусного гепатита).

При хронических гепатитах ценным методом является цитологическое исследование материала, полученного при биопсии печени. Этот метод позволяет оценить степень и характер повреждения клеток печени

Источник: http://www.fesmu.ru/www2/PolTxt/U0011/gastro1/sl9/resume9.htm

Core структурный белок

Сегодня известно минимум 10 структурных и неструктурных белков, кодируемых геномом HCV. К структурным белкам относят core, envelop 1 и envelop 2. Белок core является белком нуклеокапсида, тогда как envelop 1 и envelop 2 — гликопротеины внешней оболочки вируса. В структурной зоне кодируется также белок р7, функция которого не ясна, однако аналогия с другими представителями семейства Flaviviridae позволяет предположить, что его функция связана с высвобождением вириона из инфицированной клетки.

Этот белок отщепляется клеточной пептидазой от envelop 2, но не во всех случаях, что обусловливает существование envelop 2 в виде двух форм более и менее протяженной.

Неструктурная область генома HCV кодирует 6 белков — NS2, NS3, NS4A, NS4B, NS5A и NS5B. Белок NS2 является вирусной металлозависимой протеиназой. Белок NS4A действует как эффектор или кофактор для NSЗ-протеолитической активности в NS4A/NS4B, NS4B/NS5A, NS5A/NS5B сайтах нарезания полипротеина вируса.

В настоящее время фрагменты структурных и неструктурных белков, полученных генноинженерным путем (рекомбинантные белки) или с помощью химического синтеза, используют в качестве антигенов при конструировании иммуноферментных тест-систем. Первое поколение иммуноферментных тест-систем появилось на рынке в 1989 году и было основано на прямом ИФА. В качестве иммуносорбента были использованы фрагменты двух белков, NS3 и NS4, обозначаемых каки С100-3.

Одновременно были разработаны и подтверждающие тесты на основе иммуноблота с рекомбинантными белками (RIBA). Чувствительность этих тест-систем первого поколения составляла только 64% для ИФА и 55% для иммуноблота. Тест-системы второго поколения появились на рынке в 1991 году. В качестве антигенов, сорбированных на твердой фазе, в этих тест-системах использовали капсидные белки (фрагмент с22-3) и антигены неструктурных регионов NS3 (фрагменты с200 и сЗЗс) и NS4, что позволило повысить чувствительность и специфичность исследований. Поскольку гуморальный иммунный ответ на капсидные антигены (структурные белки) нагинается быстрее, гем на неструктурные белки, период от инфицирования до выявляемой сероконверсии удалось уменьшить до двух месяцев.

Подтверждающие тест-системы на основе иммуноблота позволяли идентифицировать участвующие в реакции антигены. Результаты, полученные при помощи этих тест-систем, интерпретировали как положительные лишь при реакции антител, находящихся в исследуемом субстрате, по крайней мере, с двумя антигенами, тогда как при наличии реакции лишь с одним из антигенов результат считали неопределенным. Было установлено, что специфичность второго поколения тест-систем зависела от источника антигенов. В 1993 году на рынке появилось третье поколение тест-систем. В дополнение к вышеупомянутым антигенам в этих тест-системах используются также антигены, аминокислотная последовательность которых соответствует иммунодоминантным участкам NS5 белков.

В тест-системах первого, второго и третьего поколений в качестве антигенов использовались или рекомбинантные, или синтетические пептиды. В настоящее время можно выделить также тест-системы четвертого поколения, в которых в качестве иммуносорбента используют сочетания рекомбинантных и синтетических пептидов.

Опыт применения тест-систем различных поколений в мире очень большой. Было установлено, что если с помощью тест-систем первого или второго поколения у больных с острым вирусным гепатитом С антитела выявляли на 10-16, а в ряде случаев инеделе от начала заболевания, то диагностикумы третьего поколения позволяли сократить этот срок до 2-3 недель. Согласно обобщенным данным чувствительность тест-систем первого, второго и третьего поколений составляет соответственно 70-80%, 92-95% и 97%.

В то же время, по данным С. Colin, 2001, чувствительность тест-систем третьего поколения составила 98,9% у пациентов с хроническими заболеваниями печени и 97,2% на специальных контрольных панелях сывороток. Достижение высокой чувствительности иммуноферментных тест-систем 3 и 4 поколения сопряжено с некоторыми проблемами в обеспечении специфичности исследований, что в ряде случаев может приводить к появлению ложноположительных результатов. В литературе имеются данные о возможных погрешностях в специфичности ELISA 3 тест-систем. Они являются общими для всех ELISA тест-систем, включая тест-системы для диагностики СПИДа.

Ложнопозитивные результаты могут быть следствием повышенного содержания в образцах гамма-глобулинов (сыворотки пациентов африканской расы, миеломная болезнь, ревматоидные факторы), заболеваний печени (цирроз, рак), аутоиммунных заболеваний (коллагенозы, аутоиммунные гепатиты), других вирусных инфекций (ВИЧ, гепатит В) и длительного хранения сывороток в меняющихся температурных условиях. Проведение какой-либо иммунизации также может сопровождаться повышением частоты ложнопозитивных реакций. Рекомендуемые в настоящее время меры по устранению этой проблемы следующие: а) повторная постановка образца в этой же ИФТС; б) повторная детекция anti-HCV в другой ИФТС; в) использование подтверждающих тестов на основе ИФА и иммуноблота.

Однако использование предлагаемых способов подтверждения результатов зачастую приводят к расхождениям в их итоговой трактовке, что показано исследованиями российских и зарубежных исследователей.

В настоящее время производители ИФТС для детекции anti-HCV достигают высокой чувствительности или за счет более полного выявления антител к NS3 или антител к антигенам core. Сравнительные исследования, выполненные на различных группах риска и специальных контрольных панелях показали, что тест-системы, лучше выявлявшие антитела к NS3, оказались несколько более чувствительными, чем тест-системы, лучше выявлявшие антитела к антигенам core. Их чувствительность составляла, соответственно 99,9% и 98,6%.

Источник: http://meduniver.com/Medical/zabolevania_pecheni/belki_i_antigeni_virusa_gepatita_c.html